PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID C.cajan_12579
Common NameKK1_012965
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Phaseoleae; Cajanus
Family LBD
Protein Properties Length: 303aa    MW: 33252.2 Da    PI: 6.984
Description LBD family protein
Gene Model
Gene Model ID Type Source Coding Sequence
C.cajan_12579genomeIIPGView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF260138.91.7e-4381071100
         DUF260   1 aCaaCkvlrrkCakdCvlapyfpaeqpkkfanvhklFGasnvlkllkalpeeeredamsslvyeAearardPvyGavgvilklqqqleqlkaelal 96 
                    +CaaCk+lrrkC+++Cv+apyfp ++p++fa+vhk+FGasnv kll++l+  +r+da++sl+yeAear+rdPvyG+vg+i+ lq++l+q ++el+ 
  C.cajan_12579   8 PCAACKFLRRKCTQECVFAPYFPPDNPQRFAYVHKVFGASNVAKLLNELSAAQRDDAVKSLAYEAEARLRDPVYGCVGLISVLQHKLRQIQVELNN 103
                    7**********************************************************************************************9 PP

         DUF260  97 lkee 100
                    +k+e
  C.cajan_12579 104 AKKE 107
                    9987 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5089126.7297108IPR004883Lateral organ boundaries, LOB
PfamPF031952.7E-438105IPR004883Lateral organ boundaries, LOB
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0009954Biological Processproximal/distal pattern formation
GO:0009965Biological Processleaf morphogenesis
GO:0048441Biological Processpetal development
Sequence ? help Back to Top
Protein Sequence    Length: 303 aa     Download sequence    Send to blast
MSSSSNSPCA ACKFLRRKCT QECVFAPYFP PDNPQRFAYV HKVFGASNVA KLLNELSAAQ  60
RDDAVKSLAY EAEARLRDPV YGCVGLISVL QHKLRQIQVE LNNAKKELAT YIGPQAFQPM  120
PGPILQHHPN NPFPSPLYAN MAAGAPPPHA GPLIIRDAQP PPPQQQSQIL EAQQLAAAVA  180
AREQQEMFRS YEHQQQQEFL RFSGGFDVGS ASSAGGFSQV SQPAGSADQL SPSLALGHFD  240
NAYHMQQPQQ GDPHPHSHHI PFEAQLLQLP PQQKQGQQQT QHQQSQLPLQ SENDECRSVG  300
PSC
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_014520349.11e-158PREDICTED: LOB domain-containing protein 36-like
SwissprotQ9FKZ35e-73LBD36_ARATH; LOB domain-containing protein 36
TrEMBLA0A151TI060.0A0A151TI06_CAJCA; LOB domain-containing protein 36
STRINGGLYMA11G06210.21e-155(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF23533484
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G66870.17e-69ASYMMETRIC LEAVES 2-like 1